483148
HSP90AB1 (Heat Shock Protein HSP 90-Beta, Heat Shock Protein 90 Alpha (Cytosolic), Class B Member 1)
Größe
£614.00
- SKU:
- 483148
- Anwendung:
- WB
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region of HSP90AB1: NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Weitere Details:
- Hsp90ab1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice