482814
HMG20B (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily E Member 1-related, High Mobility Group 20B)
Größe
£614.00
- SKU:
- 482814
- Anwendung:
- WB
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region of human HMG20B: AELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQ
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Weitere Details:
- HMG20B is required for correct progression through G2 phase of the cell cycle and entry into mitosis. HMG20B is also required for RCOR1/CoREST mediated repression of neuronal specific gene promoters. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice