480676
FAM174B (Membrane Protein FAM174B, Family with Sequence Similarity 174, Member B)
Größe
£599.00
- SKU:
- 480676
- Reinheit:
- Purified by Protein A affinity chromatography
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED from the C-Terminal of human FAM174B
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide
- Weitere Details:
- The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. Applications: Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice