ELOV1 (Elongation of Very Long Chain Fatty Acids Protein 1, ELOVL Fatty Acid Elongase 1)

Größe

£614.00

SKU:: 480138
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: RGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMV from the N-terminal region of human ELOV1.
Format:: Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
Weitere Details:: ELOV1 is a condensing enzyme that catalyzes the synthesis of both saturated and monounsaturated very long chain fatty acids (VLCFAs). It exhibits activity toward saturated C18 to C26 acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. It is important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Indirectly inhibits RPE65 via production of VLCFAs. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1ug/ml using stomach tumor lysates Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.