CHST4 (Carbohydrate Sulfotransferase 4, Carbohydrate (N-acetylglucosamine 6-O) Sulfotransferase 4)

Größe

£614.00

SKU:: 478027
Anwendung:: WB
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: QKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAP corresponding to the middle region of human CHST4. Species sequence homology: bovine, canine, equine and rabbit
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: The CHST4 gene encodes a protein that is involved in enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.