470182
THRA (AR7, EAR7, ERB-T-1, ERBA, ERBA1, MGC000261, MGC43240, NR1A1, THRA1, THRA2, c-ERBA-1)
Größe
£685.00
- SKU:
- 470182
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-410 from full length human THRA
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLK TSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGC KGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCR FKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKE EMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHW KQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITP AITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRA AVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKI EKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDLR MIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice