TCF19 (SC1, SC1-1)

Größe

£685.00

SKU:: 470176
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-345 from full length human TCF19.
Format:: Supplied as a liquid in PBS, pH 7.4
Weitere Details:: Applications: Suitable for use in Immunofluorescence, Western Blot, Immunohistochemistry, Immunocytochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRA DLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLE DHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPG TSPSEFYFMFQQVRVKPQDFAAITIPRSRGEARVGAG FRPMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRP QPLTFSPSWGGPKSLPVPAPPGEVGTTPSAPPQRNR RKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKA PLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPC CCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREA DFRCPGCRAGIQT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.