470174
SULT2B1 (HSST2)
Größe
£685.00
- SKU:
- 470174
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-365 from full length human SULT2B1
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Weitere Details:
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequende: MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGV PFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMI EIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQ YSPRLMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVVV SLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFD HIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLG RPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLD HRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM RGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNT SLEREPRPNSSPSPSPGQASETPHPRPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice