SRCRB4D (S4D-SRCRB, SRCRB-S4D)

Größe

£698.00

SKU:: 470172
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-190 from human SRCRB4D, fused to GST-Tag. MW of the GST tag alone is 26kD.
Klon:: 3E9
Format:: Supplied as a liquid.
Weitere Details:: The scavenger receptor cysteine-rich (SRCR) superfamily is an ancient and highly conserved group of cell surface and/or secreted proteins, some of which are involved in the development of the immune system and the regulation of both innate and adaptive immune responses. Group B SRCR domains usually contain 8 regularly spaced cysteines that give rise to a well-defined intradomain disulfide-bond pattern.[supplied by OMIM] Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MTGTLRTRAWPAAKRAAGLRWALRDEARLSDCFHLG WGQHNCGHHEDAGALCAGEADSEGPEELGLQVQQD GSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYLGQ RWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAH FGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDH SEDASVLCQPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.