RARRES2 (CHEMERIN, HP10433, TIG2)

Größe

£843.00

SKU:: 470136
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant Protein corresponding to aa17-163 from full length RARRES2, fused to GST-Tag
Klon:: 4C4
Format:: Supplied as a liquid in PBS, pH 7.4
Weitere Details:: This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. [provided by RefSeq] Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSV ESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKV RPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREA EEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.