470132
QSOX1 (FLJ34858, Q6, QSCN6)
Größe
£685.00
- SKU:
- 470132
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-604 from full length human QSOX1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a protein that contains domains of thioredoxin and ERV1, members of two long-standing gene families. The gene expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYS PSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCI AFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCR DFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRE RLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEE YLALIFEKGGSYLAREVALDLSQHKGVAVRRVLNTEAN VVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTA YLQRLSGLTREAAQTTVAPTTANKIAPTVWKLADRSKI YMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLA KYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTAL DDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLF HFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFG CRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNR VNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDV PVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQN VAAAPELAMGALELESRNSTLDPGKPEMMKSPTNTTP HVPAEGPELI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice