470103
PDCD1LG2 (B7DC, Btdc, CD273, MGC142238, MGC142240, PD-L2, PDCD1L2, PDL2, bA574F11.2)
Größe
£685.00
- SKU:
- 470103
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa19-220 from partial PDCD1LG2.
- Klon:
- 4A11
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Weitere Details:
- Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITA SLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVR DEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVP ETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPE GLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDL QSQMEPRTHPT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice