470102
PCSK9 (FH3, HCHOLA3, LDLCQ1, NARC-1, NARC1)
Größe
£685.00
- SKU:
- 470102
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-692 from full length human PCSK9.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a proprotein convertase belonging to the proteinase K subfamily of the secretory subtilase family. The encoded protein is synthesized as a soluble zymogen that undergoes autocatalytic intramolecular processing in the endoplasmic reticulum. The protein may function as a proprotein convertase. This protein plays a role in cholesterol homeostasis and may have a role in the differentiation of cortical neurons. Mutations in this gene have been associated with a third form of autosomal dominant familial hypercholesterolemia (HCHOLA3). [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGD YEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRL PGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKIL HVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVF AQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTS IQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDS HGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTV SGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVG ATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDC STCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELR QRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHG AGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSC SSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVY AIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGH VLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHRE ASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGST SEGAVTAVAICCRSRHLAQASQELQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice