470094
NUP62 (Nuclear Pore Glycoprotein p62, 62kD Nucleoporin, Nucleoporin Nup62)
Größe
£685.00
- SKU:
- 470094
- Anwendung:
- WB
- Reinheit:
- Purifed
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-522 from full length human NUP62.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. Multiple transcript variants of this gene encode a single protein isoform. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTS GTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGF TFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPS GFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVA PATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPAT LPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIA TAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAA SGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPAGIP SNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKW SLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHRE VEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKE QSGTIYLQHADEEREKTYKLAENIDAQLKRMAQDLKDII EHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSA LLQRKVEEVTKVCEGRRKEQERSFRITFD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice