470090
NS4ATP2 (DKFZp667L2214, FLJ11526, FLJ23595, FLJ36497, NS4ATP2)
Größe
£685.00
- SKU:
- 470090
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-183 from full length human NS4ATP2.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGE RCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYIC DFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDL FQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFR NIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice