470087
NPTX1 (DKFZp686J2446, MGC105123, NP1)
Größe
£685.00
- SKU:
- 470087
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-432 from full length human NPTX1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPV DADMCAASVAAGGAEELRSSVLQLRETVLQQKETILS QKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQP GSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLE QYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEE GKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNR PGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLK SSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILIND KVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQ GGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQ AFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIA WAESHIEIYGGATKWTFEACRQIN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice