470083
NFKB1 (DKFZp686C01211, EBP-1, KBF1, MGC54151, NF-kappa-B, NFKB-p105, NFKB-p50, p105, p50) (Not for Export EU)
Größe
£685.00
- SKU:
- 470083
- Anwendung:
- WB
- Reinheit:
- Serum
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-969 from full length human NFKB1.
- Format:
- Supplied as a liquid. No preservative added.
- Weitere Details:
- This gene encodes a 105kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50kD protein. The 105kD protein is a Rel protein-specific transcription inhibitor and the 50kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMAL PTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGAS SEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAH SLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKV FETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDR QLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDS TGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGC VTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFG DFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKS DLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSF GGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPH YGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPE GCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEV TLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFD YAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHS QLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQE DVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSI LLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLV AAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEG DAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPL VENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSW QVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQL YKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTL MDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPV KTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETS FRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice