470061
LY96 (MD-2, MD2)
Größe
£685.00
- SKU:
- 470061
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-160 from full length human LY96
- Format:
- Supplied as a liquid. No preservative added.
- Weitere Details:
- The MD-2 protein appears to associate with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKG SKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICR GSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCV VEAISGSPEEMLFCLEFVILHQPNSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice