470057
LPCAT4 (AGPAT7, AYTL3, FLJ10257, LPAAT-eta, LPEAT2)
Größe
£685.00
- SKU:
- 470057
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-524 from full length human LPCAT4.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Members of the 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. Both LPA and PA are involved in signal transduction (Ye et al., 2005 [PubMed 16243729]).[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQR VKFCLLGALLAPIRVLLAFIVLFLLWPFAWLQVAGLSEE QLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRG QRASRLQAPVLVAAPHSTFFDPIVLLPCDLPKVVSRAE NLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRA TSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPV QPVLIRYPNSLDTTSWAWRGPGVLKVLWLTASQPCSI VDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGL SAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAG AFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRL AFELFAEEQAEGPNRLLYKDGFSTILHLLLGSPHPAAT ALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTY LRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQK GD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice