470049
KRT15 (CK15, K15, K1CO)
Größe
£685.00
- SKU:
- 470049
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-456 from full length human KRT15.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. [provided by RefSeq] Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLS GGGGSRSISASSARFVSSGSGGGYGGGMRVCGFGG GAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNE KITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQK QTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDN ARLAADDFRLKYENELALRQGVEADINGLRRVLDELTL ARTDLEMQIEGLNEELAYLKKNHEEEMKEFSSQLAGQ VNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVE AWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQEL EIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGG LEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRS LLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVD GQVVSSHKREI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice