470031
HSPA1L (HSP70-1L, HSP70-HOM, HSP70T, hum70t)
Größe
£685.00
- SKU:
- 470031
- Anwendung:
- WB
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-641 from full length human HSPA1L
- Format:
- Supplied as a liquid. No preservative added.
- Weitere Details:
- This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRT TPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIG RKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGEN KAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYF NDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKG GQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTH LGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLR TACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFE ELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGST RIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAI LMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALMKR NSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNN LLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDK STGKVNKITIANDKGRLSKEEIERMVLDAEKYKAEDEV QREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNK ILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPII TKLYQGGCTGPACGTGYVPGRPATGPTIEEVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice