470026
HNF4A (FLJ39654, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14)
Größe
£685.00
- SKU:
- 470026
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-464 from full length human HNF4A.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMG NDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGA SSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKR NQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYE DSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIA DVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAH AGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEM SRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKG LSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLL LLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGS PSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSN GQMSTPETPQPSPPGGSGSEPYKLLPGAVATIVKPLS AIPQPTITKQEVI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice