470025
HMGCS2
Größe
£685.00
- SKU:
- 470025
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-508 from full length human HMGCS2.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Mitochondrial 3-hydroxy-3-methylglutaryl CoA synthase (HMGCS2; EC 2.3.3.10) mediates the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for brain, heart, kidney, and other organs during times of carbohydrate deprivation such as fasting (Robinson and Williamson, 1980 [PubMed 6986618]). Also see cytoplasmic HMG-CoA synthase (HMGCS1; MIM 142940), which mediates an early step in cholesterol synthesis.[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFST ASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKY NNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRL MERIQLPWDSVGRLEVGTETIIDKSKAVKTVLMELFQD SGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDG RYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPL ALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCY LRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMI FHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLE AFGGLKLEDTYTNKDLDKALLKASQDMFDKKTKASLYL STHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFS YGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKR LASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSL FPGTWYLERVDEQHRRKYARRPV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice