470007
GRWD1 (GRWD, KIAA1942, RRB1, WDR28)
Größe
£685.00
- SKU:
- 470007
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-446 from full length human GRWD1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- GRWD1 is a component of the 50S and 80S preribosomal complexes and plays a role in ribosome biogenesis (Gratenstein et al., 2005 [PubMed 15885502]).[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLPG RGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFDIVR DHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMH NLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMV PHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFALRR LLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFA LDWSPRVTGRLLTGDCQKNIHLWTPTDGGSWHVDQR PFVGHTRSVEDLQWSPTENTVFASCSADASIRIWDIRA APSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDG ALKIWDLRQFKSGSPVATFKQHVAPVTSVEWHPQDS GVFAASGADHQITQWDLAVERDPEAGDVEADPGLAD LPQQLLFVHQGETELKELHWHPQCPGLLVSTALSGFTI FRTISV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice