470006
GRK7 (GPRK7)
Größe
£685.00
- SKU:
- 470006
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-553 from full length human GRK7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSL ALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLA TVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVAT CASAPAPGNPQPFLSQAVATKCQAATTEEERVAAVTL AKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPV SDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKL DKKRLKKKGGEKMALLEKEILEKVSSPFIVSLAYAFESK THLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSA QIACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDL GLAVEMKGGKPITQRAGTNGYMAPEILMEKVSYSYPV DWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTL QDEVKFQHDNFTEEAKDICRLFLAKKPEQRLGSREKS DDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYAKDIA EIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEII ETGLFEELNDPNRPTGCEEGNSSKSGVCLLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice