470004
GRB10 (GRB-IR, Grb-10, IRBP, KIAA0207, MEG1, RSS)
Größe
£685.00
- SKU:
- 470004
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-536 from full length human GRB10.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASG PPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFR TSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQD VKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDD NSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKF LFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQ LLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRS GLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYN APTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMT AFRLLKYGMLLYQNYRIPQQRKALLSPFSTPVRSVSEN SLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRS TRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESH RIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNF QILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGV LPCKLKHHCIRVAL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice