FTSJ2 (DKFZp686J14194, FJH1)

Größe

£685.00

SKU:: 469998
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-246 from full length human FTSJ2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and it may be involved in the processing and modification of rRNA. This gene has been suggested to be involved in cell cycle control and DNA repair. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLT RHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGL RVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLG VDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRAD VILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPG GTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRK ESSEVYFLATQYHGRKGTVKQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.