FHL1 (FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA, bA535K18.1)

Größe

£685.00

SKU:: 469991
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protiein corresponding to aa1-280 from full length human FHL1.
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFC ANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLH PLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAG DQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGED FYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHAD CFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKC AGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSV NLANKRFVFHQEQVYCPDCAKKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.