FDFT1 (Not for Export EU)

Größe

£685.00

SKU:: 469988
Anwendung:: WB
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protien corresponding to aa1-417 from full length human FDFT1.
Format:: Supplied as a liquid. No preservative added.
Weitere Details:: This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLS SSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLV LRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFM ESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM GIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLF SASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQ GGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNE LITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLA ACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAII YQYMEEIYHRIPDSDPSSSKTRQIISTIRTQNLPNCQLIS RSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGE H Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.