FASLG (APT1LG1, CD178, CD95L, FASL, TNFSF6)

Größe

£685.00

SKU:: 469987
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-281 from full length human FASLG.
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSV PRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKK RGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKE LAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAH LTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINET GLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLV MMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLY VNVSELSLVNFEESQTFFGLYKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.