469980
F7
Größe
£685.00
- SKU:
- 469980
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Synthetic peptide corresponding to aa1-444 from full length human F7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes coagulation factor VII which is a vitamin K-dependent factor essential for hemostasis. This factor circulates in the blood in a zymogen form, and is converted to an active form by either factor IXa, factor Xa, factor XIIa, or thrombin by minor proteolysis. Upon activation of the factor VII, a heavy chain containing a catalytic domain and a light chain containing 2 EGF-like domains are generated, and two chains are held together by a disulfide bond. In the presence of factor III and calcium ions, the activated factor then further activates the coagulation cascade by converting factor IX to factor IXa and/or factor X to factor Xa. Alternative splicing of this gene results in 2 transcripts. Defects in this gene can cause coagulopathy. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVSQALRLLCLLLGLQGCLAAVFVTQEEAHGVLHRRR RANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERT KLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLP AFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKR SCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASK PQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINT IWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQS RRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPL CLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELM VLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSD GSKDSCKGDSGGPHATHYRGTWYLTGIVSWGQGCA TVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice