CXCL13 (ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13)

Größe

£685.00

SKU:: 469957
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-109 from full length human CXCL13.
Format:: Supplied as a liquid. No preservative added.
Weitere Details:: B lymphocyte chemoattractant, independently cloned and named Angie, is a CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQE SSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVD PQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.