469947
CLDN12
Größe
£685.00
- SKU:
- 469947
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-244 from full length human CLDN12
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Claudins, such as CLDN12, are components of epithelial cell tight junctions. Tight junctions regulate movement of solutes and ions through the paracellular space and prevent mixing of proteins and lipids in the outer leaflet of the apical and basolateral plasma membrane domains (Acharya et al., 2004).[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLR LITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTW YSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTA FRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSP SIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTS LILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSAR SRLSAIEIDIPVVSHTT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice