469937
CCT7 (CCT-ETA, Ccth, MGC110985, Nip7-1, TCP-1-eta)
Größe
£685.00
- SKU:
- 469937
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-543 from full length human CCT7.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTT LGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAK TLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEG LHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLL EKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQL KMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQP KKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVD AEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADR DMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVL GRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAE QFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELS KYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFD ATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVW EPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTA AGRGRGRGRPH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice