469908
BCL11A (BCL11A-L, BCL11A-S, BCL11A-XL, CTIP1, EVI9, FLJ10173, FLJ34997, HBFQTL5, KIAA1809, ZNF856)
Größe
£685.00
- SKU:
- 469908
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-243 from full length human BCL11A
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLG APEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSL CLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCL STSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTP GMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQH AQNTHGLRIYLESEHGSPLTPRVLHTPPFGVVPRELKM CGSFRMEAREPLSSEKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice