B4GALT2 (B4Gal-T2, B4Gal-T3, beta4Gal-T2)

Größe

£685.00

SKU:: 469906
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-306 from full length human B4GALT2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPV PRLPRCHPVLTRHLVLRVHRENPGVLMGGRYTPPDCT PAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGV YVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSD VDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAG YFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRI SLTGMKVSRPDIRIGRYRMIKHDRDKHNEPNPQRFTKI QNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRP PSWPPRG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice