469902
APLNR (AGTRL1, APJ, APJR, FLJ90771, MGC45246)
Größe
£685.00
- SKU:
- 469902
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-380 from full length human APLNR.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYML VFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVAD LTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNM YASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATA VLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSM VATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIA QTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPY HLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNS CLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSS SGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYS QETLVVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice