469900
ANGPTL3 (ANGPT5)
Größe
£685.00
- SKU:
- 469900
- Anwendung:
- WB
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-460 from full length human ANGPT3
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in angiopoietin-like 3 protein was shown to bind alpha-5/beta-3 integrins, and this binding induced endothelial cell adhesion and migration. This protein may also play a role in the regulation of angiogenesis. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAML DDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFD QSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMS LELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETP EHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQH SQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNE IRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH VYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGR LDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEY SFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWD HKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNK PRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDS ESFE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice