ALDH1L1 (DKFZp781N0997, FTHFD)

Größe

£843.00

SKU:: 469896
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa803-902 from partial ALDH1L1, fused to GST-Tag
Klon:: 3E9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQ SGFGKDLGEAALNEYLRVKTVTFEY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.