AGA (AGU, ASRG, GA)

Größe

£685.00

SKU:: 469892
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length protein corresponding to aa1-346 from human AGA.
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Aspartylglucosaminidase is involved in the catabolism of N-linked oligosaccharides of glycoproteins. It cleaves asparagine from N-acetylglucosamines as one of the final steps in the lysosomal breakdown of glycoproteins. The lysosomal storage disease aspartylglycosaminuria is caused by a deficiency in the AGA enzyme. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MARKSNLPVLLVPFLLCQALVRCSSPLPLVVNTWPFK NATEAAWRALASGGSALDAVESGCAMCEREQCDGSV GFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKN AIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLST SASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKP PGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTS TNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNG DILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFP EFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEK NQPTEEKVDCI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.