ADPRHL1 (ARH2)

Größe

£685.00

SKU:: 469888
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-354 from full length human ADPRHL1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases (see ART1; MIM 601625) transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases, such as ADPRHL1, reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]).[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEKFKAAMLLGSVGDALGYRNVCKENSTVGMKIQEEL QRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYW CLDDLYREMVRCYVEIVEKLPERRPDPATIEGCAQLKP NNYLLAWHTPFNEKGSGFGAATKAMCIGLRYWKPERL ETLIEVSVECGRMTHNHPTGFLGSLCTALFVSFAAQGK PLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFY FEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYR KWSSEGRGGRRGHDAPMIAYDALLAAGNSWTELCHR AMFHGGESAATGTIAGCLFGLLYGLDLVPKGLYQDLE DKEKLEDLGAALYRLSTEEK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.