Zinc Metalloproteinase Adamalysin-2, Recombinant, Crotalus Adamanteus, aa1-203, His-tag

Größe

£633.00

SKU:: 406068
Molekulargewicht:: 27.1
Reinheit:: ~90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops. Source: Recombinant protein corresponding to aa1-203 from Crotalus Adamanteus zinc metalloproteinase Adamalysin-2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.1kD Amino Acid Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.