Myoglobin, Recombinant, Mouse, aa2-154, His-tag (Mb)

Größe

£453.00

SKU:: 405998
Molekulargewicht:: 18.9
Reinheit:: ~90% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Recombinant protein corresponding to aa2-154 from mouse Myoglobin, fused to His-tag at N-terminal, expressed in yeast. Molecular Weight: ~18.9kD Amino Acid Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.