Melanoma-associated Antigen 10, Recombinant, Human, aa1-369, His-tag (MAGEA10)

Größe

£431.00

SKU:: 405987
Molekulargewicht:: 46.3
Reinheit:: ≥85% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol
Weitere Details:: Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression. Source: Recombinant protein corresponding to aa1-369 from human Melanoma-associated antigen 10, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.3kD Amino Acid Sequence: MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.