Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, His-tag (mpt64)

Größe

£657.00

SKU:: 405954
Molekulargewicht:: 24.5
Reinheit:: ~85% (SDS-PAGE)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.
Weitere Details:: Source: Recombinant protein corresponding to aa24-228 from Mycobacterium tuberculosis Immunogenic protein MPT64, fused to His-tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~24.5kD Amino Acid Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.