405873
Aquaporin-4, Recombinant, Mouse, aa253-323, His-Tag (Aqp4)
Größe
£555.00
- SKU:
- 405873
- Molekulargewicht:
- 9.9
- Reinheit:
- ≥90% (SDS-PAGE)
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol
- Weitere Details:
- Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system. Partial recombinant protein corresponding to aa253-323 from mouse Aquaporin-4, fused to 6X His-Tag at N-terminal, expressed in yeast. Swiss/UniProt Accession: P55088 Molecular Weight: ~9.9kD Amino Acid Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice