SLC31A1 (High Affinity Copper Uptake Protein 1, Copper Transporter 1, hCTR1, Solute Carrier Family 31 Member 1, COPT1, CTR1)

Größe

£620.00

SKU:: 397553
Anwendung:: WB
Reinheit:: Purified by immunoaffinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to a sequence NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ of human SLC31A1.
Format:: Supplied as a lyophilized powder from PBS, 0.05% sodium azide, 4% trehalose. Reconstitute with 200ul sterile ddH2O.
Weitere Details:: High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.