LPAR6 (Lysophosphatidic Acid Receptor 6, LPA Receptor 6, LPA-6, Oleoyl-L-Alpha-Lysophosphatidic Acid Receptor, P2Y Purinoceptor 5, P2Y5, Purinergic Receptor 5, RB Intron Encoded G-Protein Coupled Receptor, P2RY5)

Größe

£620.00

SKU:: 397470
Anwendung:: WB
Reinheit:: Purified by immunoaffinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to a sequence DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK of human LPAR6.
Format:: Supplied as a lyophilized powder from PBS, 0.05% sodium azide, 4% trehalose. Reconstitute with 200ul sterile ddH2O.
Weitere Details:: Lysophosphatidic acid receptor 6 also known as LPA6, P2RY5, and GPR87, is a protein that in humans is encoded by the LPAR6 gene. The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.