LGALS3BP (Galectin-3-Binding Protein, Basement Membrane Autoantigen p105, Lectin Galactoside-Binding Soluble 3-Binding Protein, Mac-2-Binding Protein, MAC2BP, Mac-2 BP, Tumor-Associated Antigen 90K, M2BP)

Größe

£620.00

SKU:: 397468
Reinheit:: Purified by immunoaffinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to a sequence HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR of human LGALS3BP.
Format:: Supplied as a lyophilized powder from PBS, 0.05% sodium azide, 4% trehalose. Reconstitute with 200ul sterile ddH2O.
Weitere Details:: Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (Paraffin): 0.5-2ug/ml. Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 minutes is required for staining of formalin/parffin sections Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Versandbedingungen:: Blue Ice