IKBKG (NF-Kappa-B Essential Modulator, NEMO, FIP-3, IkB Kinase-Associated Protein 1, IKKAP1, Inhibitor of Nuclear Factor Kappa-B Kinase Subunit Gamma, I-Kappa-B Kinase Subunit Gamma, IKK-Gamma, IKKG, IkB Kinase Subunit Gamma, NF-Kappa-B Essential Modifier, FIP3, NEMO)

Größe

£620.00

SKU:: 397446
Anwendung:: WB
Reinheit:: Purified by immunoaffinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to aa207-246, a sequence QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK of human IKBKG.
Format:: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Weitere Details:: Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.